PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g100630.1
Common NameMTR_4g100630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 327aa    MW: 35281.1 Da    PI: 7.306
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g100630.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.13.7e-1296140347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar     Rt+ q+ s+ qky
  Medtr4g100630.1  96 PWTEEEHRMFLLGLNKLGKGDWRGIARNYVISRTPTQVASHAQKY 140
                      8*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.83189145IPR017930Myb domain
SuperFamilySSF466897.9E-1791146IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-1892144IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.6E-1193139IPR009057Homeodomain-like
SMARTSM007173.9E-1193143IPR001005SANT/Myb domain
CDDcd001672.28E-996141No hitNo description
PfamPF002491.4E-1096140IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGIRKSASM GNLSHYSGSG SGLLNTGSNT  60
PGSPGENPDH GADGYGSEDF VPGSSSTSRE RKKGTPWTEE EHRMFLLGLN KLGKGDWRGI  120
ARNYVISRTP TQVASHAQKY FIRQSNVSRR KRRSSLFDIV ADDAPDTSMV PQDFLSANQL  180
QTETEGNNPL PAPPPLDEEC ESMDSTNSND GESASAPLKP DSNAQASAYP VVYPAYYSPF  240
FPFPLPYWSG YSPEPAPKKE THEVVKPTPV HSKSPINVDE LVGMSKLSLG ETIGDAGPST  300
LSRKLLEEGP SRQSAFHTTP ACGTVL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.140740.0flower| glandular trichome| leaf| root| seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF4684820.0EF468482.1 Medicago truncatula MYB transcription factor MYB48 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003608683.10.0MYB-like transcription factor family protein
SwissprotQ2V9B03e-34MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLD5FFH10.0D5FFH1_MEDTR; MYB transcription factor MYB48
STRINGGLYMA17G15330.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72303145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-112MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]